PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10026973
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 329aa    MW: 35426.3 Da    PI: 5.4268
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10026973genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_152.51.1e-16148204258
                  XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                  ++lkr rr+ +NRe+ArrsR+RK+a ++ Le  v++L++e  +L k+l+  ++++ +
  Lus10026973 148 ADLKRIRRMVSNRESARRSRRRKQAHLADLEIQVEQLTGESASLYKQLSDATQQYRN 204
                  689******************************************999999888875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.4E-13143203No hitNo description
SMARTSM003382.5E-15147211IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.898149201IPR004827Basic-leucine zipper domain
PfamPF001703.4E-14149203IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.64E-12150202No hitNo description
CDDcd147022.86E-6152203No hitNo description
PROSITE patternPS000360154169IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MEDQKPRDLK RRAPDGGLMV KESLVNSASQ PPAATAYSVR DDKFRGEFQG FANEIEGFFG  60
DIYSDDLFTF KTPDSMNGFA ACGGLDSLLW SHNVNSKEYN NSLPIDSQSS IYAKPKVTMS  120
ESSSEPSYGE EDAEIEAGPC EQSTNPGADL KRIRRMVSNR ESARRSRRRK QAHLADLEIQ  180
VEQLTGESAS LYKQLSDATQ QYRNADTNHR VLKSDVEALK AKVKLAEDMV ARGSLTCSMN  240
LLLPNNPPPP IPPHQVLNNH ITLPPRVANV SPTITVRGGG GGGDDVSYGG IADPAQNGGH  300
GIGNPSSISN HGVPSEAAVS CVSTDIWP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1163170RRSRRRKQ
2165170SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006382195.12e-86hypothetical protein POPTR_0006s29250g
SwissprotQ9FUD36e-59BZIP9_ARATH; Basic leucine zipper 9
TrEMBLU5GEY12e-86U5GEY1_POPTR; Uncharacterized protein
STRINGPOPTR_0006s29250.17e-86(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41953458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.11e-41basic leucine zipper 9